DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and cela1.4

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001025669.1 Gene:cela1.4 / 595061 XenbaseID:XB-GENE-22064324 Length:265 Species:Xenopus tropicalis


Alignment Length:258 Identity:78/258 - (30%)
Similarity:119/258 - (46%) Gaps:38/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 DGRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGD 205
            :|||:    |....:|...::.:.|. |...:.||.|||....|||||||  :..:....|.:||
 Frog    26 NGRVVGGINAAKNSWPWQVSLQYLSS-GYWYHTCGASLIRANRVLTAAHC--VDRSVSFRVVLGD 87

  Fly   206 LDLASEKRSVEAQLLRIEQVFAHPNYKKKMY---YDDIALLKLEKEVELTEYVRPVRLWVFPELP 267
            .::.:...:  .|.:.:.::..|.|:.....   | |||:|.|.....|..|||..:|   |...
 Frog    88 HNINANDGT--EQYISVSRIIKHANWNTNNIAAGY-DIAVLHLASSATLNNYVRLAQL---PADG 146

  Fly   268 TTIA-----FAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICA-QDY 326
            ..:|     ...|:|.||....:...|....|:||.::.|::.    :...|.|..:.:|| .|.
 Frog   147 VVLANNHGCVVTGWGRTSTGGSLAAILQQAPLSVVAHSTCSSS----SWWGSSVKTTMVCAGGDG 207

  Fly   327 ILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVF--CR-SSYPSVYTRVSSFLDWI 386
            :  |.:|.|||||||...:.|       .|.:.||.|:|..  |. |..|||:||||:::.||
 Frog   208 V--RSSCNGDSGGPLNCAVNG-------VYQVHGIVSFGSASGCNISRKPSVFTRVSAYIAWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/257 (30%)
Tryp_SPc 146..386 CDD:214473 76/255 (30%)
cela1.4NP_001025669.1 Tryp_SPc 29..263 CDD:238113 76/255 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.