DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and cela2a

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017945752.1 Gene:cela2a / 594883 XenbaseID:XB-GENE-970278 Length:269 Species:Xenopus tropicalis


Alignment Length:232 Identity:75/232 - (32%)
Similarity:111/232 - (47%) Gaps:34/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 YKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVE--AQLLRIEQVFAHPNYKKK 234
            :.|||||||..:|||||||.|.|..  ..|::|..:|    |.:|  .:::.:.::..||.:...
 Frog    56 HTCGGSLISSNWVLTAAHCISSYNT--YRVQLGKHNL----RYIEPGQKIINVSKLINHPRWDPN 114

  Fly   235 MYYD--DIALLKLEKEVELTEYVRPVRL----WVFPELPTTIAFAMGYGATSFAKPMTNRLTNLN 293
            ...:  ||:|:|||:.|:.::.|:|..|    ::.|.  ....:..|:|......|..:.|....
 Frog   115 SLGNGFDISLIKLEESVDFSDTVQPACLPPAGYILPH--QYGCYVTGWGNIRTGGPEPDILQQGL 177

  Fly   294 LTVVPNAECNAELPPLAETPSGVLESQICA-QDYILNRDTCQGDSGGPLQL-NLPGRRRGHRIHY 356
            |.||..|.|:    .......||..:.||| .|.|.:  :|.|||||||.. |..|....|    
 Frog   178 LLVVDYATCS----QWDWWGDGVRTNMICAGGDGITS--SCNGDSGGPLNCRNANGTWEVH---- 232

  Fly   357 HLIGITSYGVFCRSSY---PSVYTRVSSFLDWIELTV 390
               |:.|:|.....:|   |||::|||.|..||..|:
 Frog   233 ---GVVSFGSAAGCNYPKKPSVFSRVSEFNSWISTTI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 73/227 (32%)
Tryp_SPc 146..386 CDD:214473 72/226 (32%)
cela2aXP_017945752.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.