DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG18754

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:285 Identity:84/285 - (29%)
Similarity:126/285 - (44%) Gaps:63/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IFPN------DTAVAAD--ANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFV 184
            :.||      .|.|..|  |.:|:.:        |||.|..:.:|:..         |||  |:|
  Fly    90 VLPNKQTCGQTTPVFRDRGAENAELN--------EYPWMVLLLYENRL---------SLI--RYV 135

  Fly   185 LTAAHCT-----SIYEAPPKWVRIGDLD---LASEKRSVEAQLLRIEQVFAHPNYKKK--MYYDD 239
            ||||||.     :..:...|.||:|:..   :.||.|..... :.:.|...|..:...  .|.:|
  Fly   136 LTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLD-VEVGQTTVHQGFTSSGGTYRND 199

  Fly   240 IALLKLEKEVELTEYVRPVRLW--VFP--ELPTTIAFAMGYGATSFAKPM-TNRLTNLNLTVVPN 299
            ||||:|:..|..|:.::|:.|.  .||  :|...|:   |:..|..::.: |:.:...|     .
  Fly   200 IALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQIS---GWDPTKSSQTLITSTVKERN-----P 256

  Fly   300 AECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY 364
            |:|      |...||....||:||... ...|||.|.||.|: :.:.|  .|......|.||.||
  Fly   257 ADC------LNRYPSFRSASQVCAGGQ-RKGDTCAGISGSPV-MGIMG--SGVDEFVFLAGIASY 311

  Fly   365 G-VFCRSS-YPSVYTRVSSFLDWIE 387
            | .:|.|: .|.|||::..|.:||:
  Fly   312 GQQYCYSAGIPGVYTKIGHFSEWIK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/257 (30%)
Tryp_SPc 146..386 CDD:214473 75/256 (29%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 79/267 (30%)
Tryp_SPc 108..335 CDD:214473 77/264 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.