DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG34436

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:225 Identity:64/225 - (28%)
Similarity:102/225 - (45%) Gaps:39/225 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEK-RSVEAQLLRIEQVFAHPNYKKKMYY 237
            |.|:||.:.||:|:|.|  ::......||:|.|.:..|. .|..:....::..:.|..|:|..:.
  Fly    54 CSGALIHKYFVITSASC--VFNQERAIVRLGQLSIKQEHIVSYSSDDYHVQSAYIHRFYEKSNFE 116

  Fly   238 DDIALLKLEKEVELTEYVRPVRLW---------VFPELPTTIAFAMGYGATSFAKP--MTNRLTN 291
            .|||||:|:.:|....::||:.||         :|....|   |..|.. ..:..|  .|:::.:
  Fly   117 HDIALLELQNDVLYKAHIRPICLWLDKSDIDTQMFKRYET---FRWGID-EKYILPAAKTSKIKH 177

  Fly   292 LNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHY 356
            ::.....||   .:|.|        ..|.|||.  ..|:..|. ::|.||...:   |...:|.|
  Fly   178 ISQVKCENA---FKLYP--------QNSHICAG--YKNKSKCV-ETGSPLFKKI---RYYTKIRY 225

  Fly   357 HLIGITSYGVFCRSSYPSVYTRVSSFLDWI 386
            .|.||.|||    .|...:||.|:.::|||
  Fly   226 TLFGIQSYG----ESRTCLYTDVTKYIDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 64/225 (28%)
Tryp_SPc 146..386 CDD:214473 62/223 (28%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 64/225 (28%)
Tryp_SPc 40..251 CDD:214473 62/223 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.