DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG34437

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster


Alignment Length:261 Identity:60/261 - (22%)
Similarity:103/261 - (39%) Gaps:85/261 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 EYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQ 218
            |.|.||.:...:.      .|.|:||::::|:|.|.|  :::.....|.:|..|...:.|:...:
  Fly    39 ETPWMAFIASPTK------NCSGTLINKQYVITTASC--VFDQSESTVFLGRFDNIPQNRNRYVK 95

  Fly   219 LLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSFAK 283
             ..::.|:.|..|.|:.:..|||||.|:..|.....::|:.:|:                     
  Fly    96 -HSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWL--------------------- 138

  Fly   284 PMTNRLTNLN--------------------LTVVPNAECNAELPPLAETPSGVL--ESQICAQDY 326
               ..:||||                    :.::...:|....        |:.  :|||||.  
  Fly   139 ---GEITNLNHLESNRWGLSEKMIFQRINTVKILKIKKCRDSF--------GITLKKSQICAG-- 190

  Fly   327 ILNRDTCQGDSGGPLQLNLPGRRRGHRIHYH------LIGITSYGVFCRSSYPSVYTRVSSFLDW 385
            ..|.:.|. ::|..|.         .:|||.      ||||.||||    |...:|.:::.::||
  Fly   191 FQNGNICT-ETGSSLV---------KQIHYSGKLWNTLIGIQSYGV----SERCIYNKIAHYIDW 241

  Fly   386 I 386
            |
  Fly   242 I 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 60/261 (23%)
Tryp_SPc 146..386 CDD:214473 58/259 (22%)
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 58/259 (22%)
Tryp_SPc 39..242 CDD:304450 58/259 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455920
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.