DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:270 Identity:80/270 - (29%)
Similarity:115/270 - (42%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC------TSIYEAPPKWVRIG 204
            |.|.|..|.:|.|.::     :|:..:.||||||:.::|||||||      :||.....|| |..
Zfish    38 GGVNATHGAWPWMVSL-----QGRYGHFCGGSLINNQWVLTAAHCIVDQTPSSIIVYLGKW-RSY 96

  Fly   205 DLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL----WVFPE 265
            ..|:.|..|:       |..:..||:|......:|||||:|...|:.|:|::|:.|    ..||.
Zfish    97 VADVNSISRT-------IRHIIPHPSYSNITKDNDIALLQLTSTVQYTDYIKPICLADENSNFPR 154

  Fly   266 LPTTIAFAMGYG--------------ATSFAKPMTNRLTNLNLTVVPNAECN----AELPPLAET 312
              .|.::..|:|              ..|...|....|....|.|..||:||    ..:.|    
Zfish   155 --GTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADCNNICHGRITP---- 213

  Fly   313 PSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVY 376
                  :.|||......:.|..|||||||.....        .:...|:.|:|..| :.:.|.|:
Zfish   214 ------NMICAGTRPGGKATFSGDSGGPLMTKCS--------VWVQAGVLSHGYGCAQPNLPEVF 264

  Fly   377 TRVSSFLDWI 386
            .|||.:..||
Zfish   265 IRVSEYKQWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/270 (30%)
Tryp_SPc 146..386 CDD:214473 78/268 (29%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 78/268 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.