DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and si:dkey-21e2.15

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_003201076.1 Gene:si:dkey-21e2.15 / 567711 ZFINID:ZDB-GENE-050208-780 Length:251 Species:Danio rerio


Alignment Length:268 Identity:80/268 - (29%)
Similarity:114/268 - (42%) Gaps:60/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 DADFDGRV------LARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPK 199
            |..|..||      .|:|...|:|.::...|..     .||||||:|.||||||||         
Zfish    17 DLTFTARVGIEDGTEAKPHSRPYMVSLQKNSKN-----SCGGSLITEEFVLTAAHC--------- 67

  Fly   200 W-------VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRP 257
            |       |.:|..|| ||..:.::  ..:.....||.:..:.|.:||.||||.|:|.|:..|..
Zfish    68 WKKGDVITVVVGAHDL-SENETYDS--FEVTSYIPHPEFSWQNYENDIMLLKLNKKVTLSNNVGL 129

  Fly   258 VRLWVFPE-----LPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVL 317
            :.|   |:     ....:....|:|......|..:||......:|...||......|.: ||   
Zfish   130 ISL---PKNGEDVKEDAVCSVAGWGRLWLNGPRPDRLMEAETVIVSGEECKRRWESLFK-PS--- 187

  Fly   318 ESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYG--VFCRSS-YPSVYTRV 379
             ...|...:   ..||:|||||||...           .|.:|:||:.  ..|.|. .|::||::
Zfish   188 -KMFCVYGH---GGTCKGDSGGPLVCG-----------EHAVGVTSFSDRYSCNSRLLPNMYTKI 237

  Fly   380 SSFLDWIE 387
            |::|.||:
Zfish   238 SAYLSWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/261 (30%)
Tryp_SPc 146..386 CDD:214473 76/260 (29%)
si:dkey-21e2.15XP_003201076.1 Tryp_SPc 26..247 CDD:238113 76/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.