DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP012035

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_001689264.1 Gene:AgaP_AGAP012035 / 5668016 VectorBaseID:AGAP012035 Length:197 Species:Anopheles gambiae


Alignment Length:52 Identity:14/52 - (26%)
Similarity:21/52 - (40%) Gaps:5/52 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SNTHTQRLPPEGRMRPLQDDSIRSPVDRDIVFPELDAGPGKPEEKMWFHITD 70
            |.|..:|.|...|.|   ..:||....:|::  ....|..:|...:|..|.|
Mosquito   140 STTARRRTPTTVRTR---STTIRLDHFKDVL--PARCGEQRPSWNVWSDIED 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113
Tryp_SPc 146..386 CDD:214473
AgaP_AGAP012035XP_001689264.1 CLIP 39..95 CDD:288855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.