DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP005690

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_001688708.1 Gene:AgaP_AGAP005690 / 5667342 VectorBaseID:AGAP005690 Length:300 Species:Anopheles gambiae


Alignment Length:301 Identity:89/301 - (29%)
Similarity:128/301 - (42%) Gaps:74/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 QKYSEYVERIFPNDTAVAAD-------ANDADFDGRVLARPGEYPHMAAV--GFESDRGQVDYKC 174
            :::..|.||: |.:..|..:       .|..:      |.||::|...|:  .|.|..|    .|
Mosquito    31 EEFDHYWERL-PAELQVYREKLPSHRITNGQE------ATPGQFPFQIALISEFASGNG----LC 84

  Fly   175 GGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLAS--------EKRSV-EAQLLRIEQVFA--- 227
            |||:::..|:||||||          |..|...|||        ..|:: |:...||.  ||   
Mosquito    85 GGSVLTRNFILTAAHC----------VVSGASTLASGGVAIMGAHNRNIQESTQQRIR--FATSG 137

  Fly   228 ---HPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAF------AMGYGATSFAK 283
               ||:|......:|||.::|...:..|..::|:||   |....|..|      ..|:|.||.|.
Mosquito   138 IRRHPSYSSSTLRNDIATVRLNSPMTFTTRIQPIRL---PGRSDTRQFGGFTGTVSGFGRTSDAS 199

  Fly   284 PMTNRLTNLNLT-VVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPG 347
            ..|:.:...... |:.|.:|      :|...|.|:...:|... ...|.:|.|||||||.:...|
Mosquito   200 SATSAVVRFTTNPVMTNTDC------IARWGSTVVNQHVCLSG-AGGRSSCNGDSGGPLTVQSGG 257

  Fly   348 RRRGHRIHYHLIGITSYGVF--CRSSYPSVYTRVSSFLDWI 386
            ..:        ||:.|:|..  |....||||.||:.|||||
Mosquito   258 TMQ--------IGVVSFGSVNGCAIGMPSVYARVTFFLDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 83/267 (31%)
Tryp_SPc 146..386 CDD:214473 81/265 (31%)
AgaP_AGAP005690XP_001688708.1 Tryp_SPc 55..290 CDD:214473 82/274 (30%)
Tryp_SPc 56..290 CDD:238113 82/273 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.