DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP005688

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_001688707.1 Gene:AgaP_AGAP005688 / 5667341 VectorBaseID:AGAP005688 Length:301 Species:Anopheles gambiae


Alignment Length:253 Identity:72/253 - (28%)
Similarity:112/253 - (44%) Gaps:35/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRS 214
            |.||::|:...:..:...|..  .||||:::..|:||||||  :.......|..|...:.:..|:
Mosquito    62 ATPGQFPYQIILLSDFPTGTA--LCGGSVLTRNFILTAAHC--VVSGTNTVVSGGIAIMGAHNRT 122

  Fly   215 V-EAQLLRIEQVFA----HPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFA- 273
            : ||...||....:    ||.|.......|||::.|...:..|:.::||||   |....|..|. 
Mosquito   123 IQEASQQRIRYTASGIRYHPLYVSSTLRYDIAVVLLNSSITFTDRIQPVRL---PAQSDTRQFGG 184

  Fly   274 -----MGYGATSFAKPMTNRLTNLNLT-VVPNAECNAELPPLAETPSGVLESQICAQDYILNRDT 332
                 .|:|.|:.|....:.:...... |:.||.|....     ..|.:.:..:|... ...|.:
Mosquito   185 FVGTLSGFGRTTDASQSISTVVRFTSNPVMTNANCITRW-----GSSNIQDQNVCLSG-TGGRSS 243

  Fly   333 CQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVF--CRSSYPSVYTRVSSFLDWIEL 388
            |.|||||||.:...|..:        ||:.|:...  |.:..||||:|||.:|:|:|:
Mosquito   244 CNGDSGGPLTVESGGPIQ--------IGVVSFVSIRGCEAGMPSVYSRVSFYLNWVEI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/250 (28%)
Tryp_SPc 146..386 CDD:214473 70/249 (28%)
AgaP_AGAP005688XP_001688707.1 Tryp_SPc 55..291 CDD:214473 70/249 (28%)
Tryp_SPc 56..292 CDD:238113 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.