DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP006485

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_001688885.1 Gene:AgaP_AGAP006485 / 5667297 VectorBaseID:AGAP006485 Length:281 Species:Anopheles gambiae


Alignment Length:255 Identity:71/255 - (27%)
Similarity:116/255 - (45%) Gaps:51/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEA-----PPKW--VRIGDLDLAS 210
            |::|  :||...:   ..:..|||:::..:.|||||.|  ::.|     .|.|  ||.||:.||.
Mosquito    40 GQFP--SAVSINT---TFNVHCGGAVVDRQHVLTAAQC--VFNANLRLVDPYWITVRAGDIALAP 97

  Fly   211 EKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYV-----RPVRLWVFPELP--T 268
            .  ....|..::..:|.||.:..:....|:|:|:|::..:|....     |..|:     :|  .
Mosquito    98 V--GARRQTRKVSHIFVHPQFNIRTLEHDVAVLRLDRPYDLPSNTINLANRTRRI-----VPNGA 155

  Fly   269 TIAFAMGYGATSFA--KPMTNRLTNLNLTVVPNAECNAELPPLAETPSG-VLESQICAQDY--IL 328
            :..|| |:||::.|  .|:......|.:||.....||.     |...:| :|||.:||.:.  ..
Mosquito   156 SCQFA-GWGASTAALNAPVNVLQRFLPMTVNDRDMCNQ-----ANMHAGRMLESHLCAGNTGGSN 214

  Fly   329 NRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
            |...|.|::|           .|......|:|..|:|:.| .::.|.|:|:|..:.||||
Mosquito   215 NAAPCNGNAG-----------TGLYCERALVGTLSFGLNCGAANNPPVFTQVRFYNDWIE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/253 (27%)
Tryp_SPc 146..386 CDD:214473 68/252 (27%)
AgaP_AGAP006485XP_001688885.1 Tryp_SPc 30..262 CDD:214473 68/252 (27%)
Tryp_SPc 32..265 CDD:238113 71/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.