DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:243 Identity:85/243 - (34%)
Similarity:121/243 - (49%) Gaps:41/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 VGFESDRGQVDYKCGGSLISERFVLTAAHC----TSIYEAPPKW-VRIGDLDLASEKRSVEAQLL 220
            |..:.|:..|   ||||::...:|||||||    |.::    .| ||.|...|.|......|:::
Human   220 VSIQYDKQHV---CGGSILDPHWVLTAAHCFRKHTDVF----NWKVRAGSDKLGSFPSLAVAKII 277

  Fly   221 RIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE--LPTTIAFAMGYGATSFAK 283
            .||   .:|.|.|.   :||||:||:..:..:..|||:.|..|.|  .|.|..:.:|:|   |.|
Human   278 IIE---FNPMYPKD---NDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWG---FTK 333

  Fly   284 ----PMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLN 344
                .|::.|...::.|:.:..|||:.....|    |.|..:||.......|||||||||||...
Human   334 QNGGKMSDILLQASVQVIDSTRCNADDAYQGE----VTEKMMCAGIPEGGVDTCQGDSGGPLMYQ 394

  Fly   345 LPGRRRGHRIHYHLIGITSYGVFCRS-SYPSVYTRVSSFLDWIELTVW 391
            ..        .:|::||.|:|..|.. |.|.|||:||::|:|| ..||
Human   395 SD--------QWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWI-YNVW 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 82/237 (35%)
Tryp_SPc 146..386 CDD:214473 81/236 (34%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335
Tryp_SPc 204..429 CDD:214473 81/236 (34%)
Tryp_SPc 205..432 CDD:238113 83/240 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.