DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AZU1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:253 Identity:67/253 - (26%)
Similarity:103/253 - (40%) Gaps:46/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLD 207
            |..|...|||.::|.:|::     :.|..:.|||:||..|||:|||.|..........|.:|..|
Human    26 DIVGGRKARPRQFPFLASI-----QNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYD 85

  Fly   208 LASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPT---- 268
            |...:|. ..|...|..: :...|..:...:|:.||:|::|..||..|.     :.| ||.    
Human    86 LRRRERQ-SRQTFSISSM-SENGYDPQQNLNDLMLLQLDREANLTSSVT-----ILP-LPLQNAT 142

  Fly   269 ----TIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILN 329
                |.....|:|:......::.....:|:||.|..:|.         |:.|....:..:..|  
Human   143 VEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCR---------PNNVCTGVLTRRGGI-- 196

  Fly   330 RDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWIE 387
               |.||.|.||..    ....|       |:.|:.:......|..:|||:.|.|||:
Human   197 ---CNGDGGTPLVC----EGLAH-------GVASFSLGPCGRGPDFFTRVALFRDWID 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 65/248 (26%)
Tryp_SPc 146..386 CDD:214473 64/247 (26%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 65/250 (26%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 13/23 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.