DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and PRSS8

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:268 Identity:85/268 - (31%)
Similarity:129/268 - (48%) Gaps:38/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 ANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC------TSIYEAP 197
            |..|...|...|..|::|...::.:|.     .:.|||||:||::||:||||      ...||  
Human    40 APQARITGGSSAVAGQWPWQVSITYEG-----VHVCGGSLVSEQWVLSAAHCFPSEHHKEAYE-- 97

  Fly   198 PKWVRIG--DLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL 260
               |::|  .||..||    :|::..::.:..||:|.::....|||||:|.:.:..:.|:||:.|
Human    98 ---VKLGAHQLDSYSE----DAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICL 155

  Fly   261 WV----FPE-LPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNA--ELPPLAETPSGVLE 318
            ..    ||. |..|:. ..|:.|.|.:......|..|.:.::....||.  .:....|.|..|.|
Human   156 PAANASFPNGLHCTVT-GWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQE 219

  Fly   319 SQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRS-SYPSVYTRVSSF 382
            ..:||......:|.|||||||||...:.|.       ::|.||.|:|..|.: :.|.|||..||:
Human   220 DMVCAGYVEGGKDACQGDSGGPLSCPVEGL-------WYLTGIVSWGDACGARNRPGVYTLASSY 277

  Fly   383 LDWIELTV 390
            ..||:..|
Human   278 ASWIQSKV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 81/256 (32%)
Tryp_SPc 146..386 CDD:214473 80/255 (31%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 80/258 (31%)
Tryp_SPc 45..284 CDD:238113 82/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.