DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and tmprss13a

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001152984.1 Gene:tmprss13a / 559754 ZFINID:ZDB-GENE-090309-3 Length:506 Species:Danio rerio


Alignment Length:278 Identity:78/278 - (28%)
Similarity:133/278 - (47%) Gaps:51/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 NDTAVAADAND-------ADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAA 188
            :|.:|:...:|       :...|...:..|:||...::.:..     .:.|||:|||..|:::||
Zfish   249 DDKSVSLQCSDCGKQQSSSRIIGGTTSELGQYPWQVSLHYNK-----AHVCGGTLISPDFIVSAA 308

  Fly   189 HC------TSIYEAPPKW-VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLE 246
            ||      .|.|     | |.:|.:    .::|:....| ::::.....|......:|:|||.|.
Zfish   309 HCFQGKMANSAY-----WLVYVGIV----SQQSLGMPYL-VKKIIVSEKYNSDTNDNDVALLILS 363

  Fly   247 KEVELTEYVRPVRLWVFPELPTTIA-----FAMGYGAT-SFAKPMTNRLTNLNLTVVPNAECNAE 305
            :.|..:...:||.|   |....|.:     :..|:|.| ..|...::.|.::::.::.::.||: 
Zfish   364 RPVAFSYTTQPVCL---PTFNQTFSGGLQCWTSGFGTTKQGADRASSSLMSVSVNIIDSSVCNS- 424

  Fly   306 LPPLAETPSGVL-ESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC- 368
                .:...|:: .:.|||.|....||:|||||||||.......|      ::|:||||:|..| 
Zfish   425 ----CQIYCGLITNNMICAGDLKGGRDSCQGDSGGPLVCKDDNNR------WYLVGITSWGAGCG 479

  Fly   369 RSSYPSVYTRVSSFLDWI 386
            :...|.||:||:|||.||
Zfish   480 QKQKPGVYSRVTSFLPWI 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 75/256 (29%)
Tryp_SPc 146..386 CDD:214473 73/254 (29%)
tmprss13aNP_001152984.1 SRCR_2 178..261 CDD:295335 3/11 (27%)
Tryp_SPc 268..497 CDD:214473 73/257 (28%)
Tryp_SPc 269..497 CDD:238113 73/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.