DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and KLK15

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:270 Identity:81/270 - (30%)
Similarity:122/270 - (45%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPP 198
            :.||...|...:|...| |...|...|:   .:||:  :.||.||||..:||:||||.|.:..  
Human    13 STAAQDGDKLLEGDECA-PHSQPWQVAL---YERGR--FNCGASLISPHWVLSAAHCQSRFMR-- 69

  Fly   199 KWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVF 263
              ||:|:.:|  .||....||....:|..||.|:.:.:.:||.||:|.:...|...|||..|...
Human    70 --VRLGEHNL--RKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTR 130

  Fly   264 PELPTTIAFAMGYGATSFAKPMT-----------NRLTNLNLTVVPNAECNAELPPLAETPSGVL 317
            ...|.......|:|..|..:|.|           :.|...|::::.:..|:...      |..:.
Human   131 CPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSY------PGRLT 189

  Fly   318 ESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYG-VFC-RSSYPSVYTRVS 380
            .:.:||.......::|:|||||||...           ..|.||.|:| |.| .::.|.|||:|.
Human   190 NTMVCAGAEGRGAESCEGDSGGPLVCG-----------GILQGIVSWGDVPCDNTTKPGVYTKVC 243

  Fly   381 SFLDWIELTV 390
            .:|:||..|:
Human   244 HYLEWIRETM 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/253 (30%)
Tryp_SPc 146..386 CDD:214473 75/252 (30%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.