DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and zgc:100868

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:220 Identity:71/220 - (32%)
Similarity:109/220 - (49%) Gaps:21/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLAS-EKRSVEAQLLRIEQVFAHPNYKKKMYY 237
            ||||||:.:::||||||..........|.:|...||| |..|:.:   .:..:..||||......
Zfish    62 CGGSLINNQWILTAAHCFPNPSTTGLLVYLGLQKLASFESYSMSS---AVSNIIKHPNYNSDTED 123

  Fly   238 DDIALLKLEKEVELTEYVRPVRLWVFPE--LPTTIAFAMGYG--ATSFAKPMTNRLTNLNLTVVP 298
            :||.||:|...|..:.|:||:.|.....  ...|:.:..|:|  ||..:.|....|..:.:.:|.
Zfish   124 NDITLLQLASTVSFSNYIRPICLAASDSTFFNGTLVWITGWGNTATGVSLPSPGTLQEVQVPIVG 188

  Fly   299 NAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITS 363
            |.:||.     ....|.:.::.:||......:|:||||||||:.     .::|.  .:...||.|
Zfish   189 NRKCNC-----LYGVSKITDNMVCAGLLQGGKDSCQGDSGGPMV-----SKQGS--VWIQSGIVS 241

  Fly   364 YGVFC-RSSYPSVYTRVSSFLDWIE 387
            :|..| :.::|.||||||.:..||:
Zfish   242 FGTGCAQPNFPGVYTRVSKYQSWIQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 70/218 (32%)
Tryp_SPc 146..386 CDD:214473 69/217 (32%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 69/217 (32%)
Tryp_SPc 37..267 CDD:238113 71/220 (32%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.