DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and zgc:112038

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:244 Identity:82/244 - (33%)
Similarity:115/244 - (47%) Gaps:34/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIG-DLDLASEKRSVE 216
            |.:|..|::...|..   |:.||||||::.:||:||||..|.......:.:| .....|....:.
Zfish    44 GSWPWQASIHRISPE---DHICGGSLINKDWVLSAAHCFMITATANIKIFLGRQFQTGSNPNEIS 105

  Fly   217 AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGA--T 279
            ..|   .|:..||:|......:|||||:|...|..|:|:|||.|     ......||.|..:  |
Zfish   106 RTL---TQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCL-----ASADSVFAGGTKSWIT 162

  Fly   280 SFAK------PMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSG 338
            .:.|      .:||.|..:.|.||.|.||||:...:      :.::.|||......:|.||||||
Zfish   163 GWDKHRSSDIQVTNVLQEVQLPVVSNTECNADYKGI------ITDNMICAGINEGGKDACQGDSG 221

  Fly   339 GPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            ||:.     .:.|.|  :...||.|:|..| ...||.:|||||.:..||
Zfish   222 GPMV-----SQNGSR--WIQSGIVSFGRECGLPRYPGIYTRVSQYQSWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 82/244 (34%)
Tryp_SPc 146..386 CDD:214473 80/242 (33%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 80/242 (33%)
Tryp_SPc 37..263 CDD:238113 80/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.