DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC548809

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001016055.2 Gene:LOC548809 / 548809 -ID:- Length:334 Species:Xenopus tropicalis


Alignment Length:261 Identity:76/261 - (29%)
Similarity:115/261 - (44%) Gaps:53/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW-VRIGDLDLASEKR 213
            |..|.:|...::.::.     .:.||||:||.::::|||||......|..: |.:|...|:  ..
 Frog    64 ATNGAWPWQISLRYKG-----SHICGGSVISNQWIMTAAHCFEYSRTPSDYQVLLGAYQLS--VA 121

  Fly   214 SVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPV-------------RLWVFPE 265
            |....|..:.:|..:|::.......|||||||...|..|||:.||             :.||   
 Frog   122 SASELLSSVARVIVNPSFTIPGGPGDIALLKLTSPVAYTEYILPVCVPSSASGFYEGMQCWV--- 183

  Fly   266 LPTTIAFAMGYG--ATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSG-------VLESQI 321
                    .|:|  .::...|....|..:...::..:.||    .:....||       |.:.||
 Frog   184 --------TGWGNIGSAVTLPYPQTLQQVMTPLISWSTCN----QMYHVQSGISSNIAIVPKDQI 236

  Fly   322 CAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDW 385
            ||......:|:|||||||||...|.|       .::.|||.|:|..| ::|.|.|||.|.:|..|
 Frog   237 CAGYAAGQKDSCQGDSGGPLVCQLQG-------VWYQIGIVSWGDGCAQASRPGVYTLVPNFKSW 294

  Fly   386 I 386
            :
 Frog   295 L 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/261 (29%)
Tryp_SPc 146..386 CDD:214473 75/259 (29%)
LOC548809NP_001016055.2 Tryp_SPc 57..294 CDD:214473 75/258 (29%)
Tryp_SPc 58..297 CDD:238113 76/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.