DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and f10

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001015728.1 Gene:f10 / 548445 XenbaseID:XB-GENE-971433 Length:464 Species:Xenopus tropicalis


Alignment Length:308 Identity:78/308 - (25%)
Similarity:131/308 - (42%) Gaps:56/308 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 KKENKQRRLCE---QKYSEYVERIFPNDTAVAADANDADFD-------------GRVLARPGEYP 156
            |:|.::.:|.|   :.:::....:..|.|....:.|....:             ||..:: ||.|
 Frog   177 KRERRETKLHENDKKNHTDSQNEVKMNQTGTLPERNVTGINILNPNDPNVRIVGGRECSQ-GECP 240

  Fly   157 HMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC---TSIYEAPPKWVRIGDLD--LASEKRSVE 216
            ..|.:..:.|.|    .|||:::|..|:||||||   |..::     |.:|:|:  ::....|:.
 Frog   241 WQALLVSDEDEG----FCGGTILSREFILTAAHCMNQTKYFK-----VVVGELNTKISEGTESIH 296

  Fly   217 AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTI------AFAMG 275
                ::|::..||.:.|..|..|||::||::.:..||.:.|..: ..||....:      |...|
 Frog   297 ----KVEKIIMHPRFVKSTYDYDIAVIKLKEAINFTENIIPACI-PDPEFADQVLMNEPDAMVSG 356

  Fly   276 YGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGP 340
            :|.........:.|..|.:..:....|.      ..:...:.|:..||......:|.||||||||
 Frog   357 FGRIHERGRQASTLQMLQVPYIKRHSCK------ESSTFAITENMFCAGFDTEVKDACQGDSGGP 415

  Fly   341 LQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
            ......|.       |.:.||.|:|..| |.....|||:||....|::
 Frog   416 HVTPFKGT-------YFVTGIVSWGEGCARKGKFGVYTKVSKLHRWLK 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/252 (28%)
Tryp_SPc 146..386 CDD:214473 70/251 (28%)
f10NP_001015728.1 GLA 22..84 CDD:214503
EGF_CA 85..121 CDD:238011
FXa_inhibition 128..163 CDD:373209
Tryp_SPc 228..456 CDD:238113 71/255 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.