DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and prss60.2

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:252 Identity:84/252 - (33%)
Similarity:113/252 - (44%) Gaps:34/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIG-----D 205
            |.|.|..|.:|..  |..:|.| ...:.|||||||..:|||||||..........|.:|     .
Zfish    36 GGVNAPEGSWPWQ--VSLQSPR-YGGHFCGGSLISSEWVLTAAHCLPGVSESSLVVYLGRRTQQG 97

  Fly   206 LDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPT-- 268
            ::.....|:|       .::..|.:|......:|||||:|...|...:|:|||.|.....:.:  
Zfish    98 VNTHETSRNV-------AKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPVCLAAQNSVYSAG 155

  Fly   269 TIAFAMGYG--ATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSG-VLESQICAQDYILNR 330
            |.::..|:|  ......|....|....:.||.|..|||:|      .|| |..:.|||......:
Zfish   156 TSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRCNAQL------GSGTVTNNMICAGLAKGGK 214

  Fly   331 DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRS-SYPSVYTRVSSFLDWI 386
            ||||||||||:...|       ...:...||||:|..|.. :.|.||||||.:..||
Zfish   215 DTCQGDSGGPMVTRL-------CTVWIQAGITSWGYGCADPNSPGVYTRVSQYQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 84/252 (33%)
Tryp_SPc 146..386 CDD:214473 82/250 (33%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 82/250 (33%)
Tryp_SPc 34..267 CDD:238113 84/252 (33%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.