DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Prss44

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:348 Identity:95/348 - (27%)
Similarity:143/348 - (41%) Gaps:88/348 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GPTQPKPKPRQYPPPPMPGQPFPPPPGGFKKKENKQRRLCEQKYSEYVERIFPNDTAVAADANDA 142
            |...|...|::.|...||....|..|||                     .:.|.|:......:  
  Rat    43 GLDDPGVNPQERPLTGMPETSLPLKPGG---------------------SMTPFDSMGFTPGH-- 84

  Fly   143 DFDGRVLAR---PGEYPHMAAVGFESDR-------------GQVDYK------CGGSLISERFVL 185
            .|....|:|   |...|..:|.|..:.|             .||..:      |||||||:.:|:
  Rat    85 SFSSMSLSRQSFPPWIPPTSACGHRTARIVGGKPAPIRKWPWQVSLQVHKQHICGGSLISKWWVM 149

  Fly   186 TAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYK-KKMYYDDIALLKLEKEV 249
            |||||  :|......|.:|:.||.| ..||:   :.::.:..|.:|. .:....||||:.|...|
  Rat   150 TAAHC--VYGHLDYVVSMGEADLWS-SMSVK---IPVQDIIVHQDYSVMRTIVHDIALVLLAFPV 208

  Fly   250 ELTEYVRPVRLWVFPE-----LPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPL 309
            ..:..::||   ..||     .|.|:.:..|:|.|......:..|..::|:::.:..||..|..:
  Rat   209 NYSVNIQPV---CIPEKSFLVQPGTLCWVTGWGKTIERGRSSRVLREVDLSIIRHERCNQILKDI 270

  Fly   310 AETPSG-----VLESQICAQDYILNR---DTCQGDSGGPL--QLNLPGRRRGHRIHYHLIGITSY 364
                :|     |.|..:|.    .|:   |.||||||||:  :.|..         :..:||.|:
  Rat   271 ----TGRIFTLVQEGGVCG----YNKKGGDACQGDSGGPMVCEFNKT---------WVQVGIVSW 318

  Fly   365 GVFC-RSSYPSVYTRVSSFLDWI 386
            |:.| |..||.:||.||.:.|||
  Rat   319 GLGCGRIGYPGIYTEVSYYRDWI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 82/280 (29%)
Tryp_SPc 146..386 CDD:214473 80/278 (29%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 74/254 (29%)
Tryp_SPc 113..341 CDD:238113 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.