DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and cela1.2

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001011493.1 Gene:cela1.2 / 496993 XenbaseID:XB-GENE-5739190 Length:265 Species:Xenopus tropicalis


Alignment Length:269 Identity:78/269 - (28%)
Similarity:124/269 - (46%) Gaps:38/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 NDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYE 195
            ||..:..| ::....|..:.| ..:|...::.:.|. |...:.||||||....|||||||  :..
 Frog    18 NDIRLIED-HERVIGGTEVQR-NSWPWQVSLQYLSG-GSWYHTCGGSLIRANRVLTAAHC--VDR 77

  Fly   196 APPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMY---YDDIALLKLEKEVELTEYVRP 257
            |....|.:||.::.....:  .|.:.:.::..|.|:.....   | ||::|.|.....|..||:.
 Frog    78 AVSYRVVVGDHNIYQNDGT--EQYISVSRIVKHANWNPNNIAAGY-DISILHLSSSATLNSYVKL 139

  Fly   258 VRLWVFPELPTTIA-----FAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVL 317
            .:|   |.....:|     ...|:|.||....:.:.|....|.|:.::.|::.    :...|.|.
 Frog   140 AQL---PADNVVLAHNYNCVVTGWGKTSNNGNLASVLQQAPLPVIAHSTCSSG----SYWGSTVK 197

  Fly   318 ESQICA-QDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY--GVFCRSSY--PSVYT 377
            .:.:|| .|.:  |..|||||||||...:.|       .|.:.|:||:  ...| |:|  |:|:|
 Frog   198 STMVCAGGDGV--RSGCQGDSGGPLNCPVNG-------VYQVHGVTSFVSSSGC-STYLKPTVFT 252

  Fly   378 RVSSFLDWI 386
            |||:::.||
 Frog   253 RVSAYIGWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 75/254 (30%)
Tryp_SPc 146..386 CDD:214473 73/252 (29%)
cela1.2NP_001011493.1 Tryp_SPc 29..264 CDD:238113 75/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.