DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and ctrc

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001008077.1 Gene:ctrc / 493439 XenbaseID:XB-GENE-5790348 Length:268 Species:Xenopus tropicalis


Alignment Length:279 Identity:84/279 - (30%)
Similarity:126/279 - (45%) Gaps:45/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 YSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVL 185
            ||..|..:.|..|.|....:         ..|..:|...::.::...|...:.|||:||||::||
 Frog    15 YSCGVPAVAPKVTRVVGGED---------VVPHSWPWQISLQYQGTSGAWGHTCGGTLISEQWVL 70

  Fly   186 TAAHCTS---IYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEK 247
            |||||.|   :|.     |.:|...|..::  .||..:..|::..|..:......:||||:||.:
 Frog    71 TAAHCISSGRVYR-----VFLGKHSLQQDE--AEAVAITPEKIIVHEKWNSLFIINDIALIKLSQ 128

  Fly   248 EVELTEYVRPVRLWVFPELPTTIA-----FAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELP 307
            ...|:|.::|.   ..|.....:|     |..|:|......|:.:.|....|.||.:|.|.    
 Frog   129 PAPLSEAIQPA---CIPSSGAILANDFPCFVTGWGRLYTNGPIADNLQQALLPVVDHATCT---- 186

  Fly   308 PLAE-TPSGVLESQICA-QDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRS 370
             |.: ..|.|..:.:|| .|.|::  .|.|||||||.....|  ....:|    ||.|:|.....
 Frog   187 -LRDWWGSQVQTTMVCAGGDGIVS--GCNGDSGGPLNCQAAG--GAWEVH----GIVSFGSGISC 242

  Fly   371 SY---PSVYTRVSSFLDWI 386
            :|   |:|:||||::.|||
 Frog   243 NYAKKPTVFTRVSAYNDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/254 (31%)
Tryp_SPc 146..386 CDD:214473 76/252 (30%)
ctrcNP_001008077.1 Tryp_SPc 29..264 CDD:238113 79/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.