DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and ACR

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001088.2 Gene:ACR / 49 HGNCID:126 Length:421 Species:Homo sapiens


Alignment Length:260 Identity:73/260 - (28%)
Similarity:122/260 - (46%) Gaps:38/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC----TSIYEAPPKW-VRIGD 205
            |...|:.|.:|.|.::...:......:.|||||::.|:|||||||    .::::    | :..|.
Human    45 GGKAAQHGAWPWMVSLQIFTYNSHRYHTCGGSLLNSRWVLTAAHCFVGKNNVHD----WRLVFGA 105

  Fly   206 LDLA-SEKRSVEAQLLR--IEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE-L 266
            .::. ...:.|:|.|..  :|::..|..|......:||||:::...:....::.|..|..|.. |
Human   106 KEITYGNNKPVKAPLQERYVEKIIIHEKYNSATEGNDIALVEITPPISCGRFIGPGCLPHFKAGL 170

  Fly   267 P--TTIAFAMGYGATSFAKP------MTNRLTNLNLTVVPNAECNAELPPLAETPSG-VLESQIC 322
            |  :...:..|:|......|      |..|:..::|.:     ||:     .:..:| |..:.:|
Human   171 PRGSQSCWVAGWGYIEEKAPRPSSILMEARVDLIDLDL-----CNS-----TQWYNGRVQPTNVC 225

  Fly   323 AQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            |...:...|||||||||||..     :......|.::||||:||.| |:..|.:||....:|:||
Human   226 AGYPVGKIDTCQGDSGGPLMC-----KDSKESAYVVVGITSWGVGCARAKRPGIYTATWPYLNWI 285

  Fly   387  386
            Human   286  285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 73/260 (28%)
Tryp_SPc 146..386 CDD:214473 71/258 (28%)
ACRNP_001088.2 Tryp_SPc 42..285 CDD:214473 71/258 (28%)
Tryp_SPc 43..288 CDD:238113 73/260 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..316
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..383
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.