DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP009251

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_001238247.1 Gene:AgaP_AGAP009251 / 4578163 VectorBaseID:AGAP009251 Length:294 Species:Anopheles gambiae


Alignment Length:288 Identity:79/288 - (27%)
Similarity:125/288 - (43%) Gaps:67/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CEQKYSEY--VERIFPNDTAVAADANDADFDGRVLARP----GEYPHMAAVGFESDRGQVDYKCG 175
            |..:|.::  ||..:|                 |..||    .::||:..:|:....|.|.:.|.
Mosquito    51 CHMRYYKHSLVESSYP-----------------VFQRPHQKMSDFPHLGRIGWTGTDGTVRWNCS 98

  Fly   176 GSLISERFVLTAAHCTSIYEA-PPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDD 239
            |:|:.|.|:||:|.||:...: .|..||:|        .|.|.|.::|.:...||.|::.:...|
Mosquito    99 GTLVWENFILTSARCTTGGNSMAPDVVRLG--------ASGEMQEIKIAEAVRHPEYREGITQHD 155

  Fly   240 IALLKLEKEVELTEYVRPVRLWVFPEL---PTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAE 301
            ||||:|:.:|||...|.|...|...::   ..|:|...|..|:...|                  
Mosquito   156 IALLRLQSKVELGSTVVPACFWNNEDVKFHAMTLAGWSGSDASDVVK------------------ 202

  Fly   302 CNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQ--LNLPGRRRGHRIHYHLIGITSY 364
              |::.|..:....:|.:.:|.:...|.  :|.  .||.||  ||..|:.....:   .||..| 
Mosquito   203 --AQVQPTLDGCDRMLSTDLCVESTELG--SCL--DGGFLQVPLNHNGKVTPFVV---AIGAPS- 257

  Fly   365 GVFCRSSYPSVYTRVSSFLDWIELTVWA 392
            .:.|:.|.|  ||:|||::.||..|:.|
Mosquito   258 NISCQKSTP--YTKVSSYVQWIVSTIQA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/250 (28%)
Tryp_SPc 146..386 CDD:214473 70/249 (28%)
AgaP_AGAP009251XP_001238247.1 Tryp_SPc 74..280 CDD:304450 69/243 (28%)
Tryp_SPc 77..277 CDD:214473 67/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.