DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP010628

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_001230577.1 Gene:AgaP_AGAP010628 / 4577753 VectorBaseID:AGAP010628 Length:211 Species:Anopheles gambiae


Alignment Length:156 Identity:46/156 - (29%)
Similarity:65/156 - (41%) Gaps:30/156 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ENKQRRLCEQKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKC 174
            :||...|...|..|....|        :...|||   .:|.:  |.|.:..|..|.. |.|:   
Mosquito    36 DNKDVYLNRYKRQEATHNI--------STYQDAD---HILYK--EIPFLVFVETEVP-GIVN--- 83

  Fly   175 GGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDD 239
            .|.||||.|||..||...      :..::..:.:|.|:.::..::       .||.|:.|..:.|
Mosquito    84 PGILISENFVLIPAHLIK------RNTKVTFVLIARERFTISKKI-------RHPMYRGKQKHFD 135

  Fly   240 IALLKLEKEVELTEYVRPVRLWVFPE 265
            |.|||||..|.|...|.|..||:..|
Mosquito   136 IGLLKLENNVNLQSNVLPACLWLNDE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 37/120 (31%)
Tryp_SPc 146..386 CDD:214473 37/120 (31%)
AgaP_AGAP010628XP_001230577.1 Tryp_SPc 85..>209 CDD:304450 30/90 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.