DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP011429

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_001237986.1 Gene:AgaP_AGAP011429 / 4577523 VectorBaseID:AGAP011429 Length:213 Species:Anopheles gambiae


Alignment Length:176 Identity:66/176 - (37%)
Similarity:93/176 - (52%) Gaps:3/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFV 184
            |..|..|..|| .|.|...::...:.|. .|..||:.||||:|:......:||.||||||:.|||
Mosquito    34 KSFEDCELRFP-ATKVDESSHIESYGGE-RAYKGEFQHMAAIGWTRSGATIDYLCGGSLITWRFV 96

  Fly   185 LTAAHCT-SIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKE 248
            |||:||: .....||..||:||.||||......||.:.|.:...||.|::...|.|||:::|||.
Mosquito    97 LTASHCSVDSNNLPPDTVRLGDTDLASTDDDESAQQIPIARFIKHPQYRESRKYYDIAVVELEKN 161

  Fly   249 VELTEYVRPVRLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNL 294
            |.....:....:|...|.|..:..|:|:||..|.:.::..|..:.|
Mosquito   162 VIPNSAICVACVWRELEAPGDLLDAVGFGALGFGEKLSPTLQKVKL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 59/150 (39%)
Tryp_SPc 146..386 CDD:214473 59/150 (39%)
AgaP_AGAP011429XP_001237986.1 Tryp_SPc 58..>211 CDD:304450 59/151 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.