DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP006675

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_001237857.2 Gene:AgaP_AGAP006675 / 4576700 VectorBaseID:AGAP006675 Length:302 Species:Anopheles gambiae


Alignment Length:261 Identity:80/261 - (30%)
Similarity:115/261 - (44%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAV--GFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEK 212
            |.||::|:..|:  .|.:..|    .|||::|:..|:||||||  :.:........|...|.:..
Mosquito    62 AVPGQFPYQIALLSNFAAGGG----LCGGTIITNTFILTAAHC--VVDGAGALATDGTAILGAHN 120

  Fly   213 R-SVEAQLLRI----EQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPT---- 268
            | :.|....||    :.||.||:|...:..:|||.::|.......|.|:|:      |||.    
Mosquito   121 RTATEPTQQRIGFVRDGVFVHPSYSATLIRNDIATVRLNSPAVFNERVQPI------ELPARSDS 179

  Fly   269 -----TIAFAMGYGATSFAKP-MTNRLTNLNLTVVPNAEC----NAELPPLAETPSGVLESQICA 323
                 .|..|.|:|.||.|.| .::.:...:..|:.||.|    |..|         |.:..:|.
Mosquito   180 RTFAGMIGTASGFGRTSDALPGASDVVMYTSNPVMTNAACVSAWNIIL---------VSDQNVCL 235

  Fly   324 QDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY--GVFCRSSYPSVYTRVSSFLDWI 386
             |....|..|.|||||||.:...|....       |||.|:  ...|.|..|||:.|:|.:.|:|
Mosquito   236 -DATGGRSVCNGDSGGPLTVQDGGESLE-------IGIASFVSAQGCASGIPSVWVRISFYRDFI 292

  Fly   387 E 387
            |
Mosquito   293 E 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/259 (30%)
Tryp_SPc 146..386 CDD:214473 78/258 (30%)
AgaP_AGAP006675XP_001237857.2 Tryp_SPc 55..292 CDD:214473 78/258 (30%)
Tryp_SPc 56..295 CDD:238113 80/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.