DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and st14

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_012821897.2 Gene:st14 / 448647 XenbaseID:XB-GENE-1008784 Length:845 Species:Xenopus tropicalis


Alignment Length:261 Identity:75/261 - (28%)
Similarity:121/261 - (46%) Gaps:48/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC-----TSIYEAPPKWVRIGD 205
            |.|.|..||:|...::..:.::    :.||.||:|...:::||||     :..|.....|.....
 Frog   607 GGVNADTGEFPWQVSLHVKGNK----HTCGASLVSPTMLISAAHCFQDDQSMRYSDASLWTAYLG 667

  Fly   206 LDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTI 270
            |...::..|.:....:|:::.||..:....|.:||::|:|||.|:.|::::|:   ..||  :|.
 Frog   668 LHDQAQLNSKDVVERKIKRIMAHIGFNDNTYDNDISVLELEKPVDYTDFIQPI---CIPE--STH 727

  Fly   271 AFAM-------GYGATSFAKPMTNRLTNLNLTVVPNAECN----AELPPLAETPSGVLESQICAQ 324
            .|.:       |:||..........|....:.::...|||    .:|.|          ..:||.
 Frog   728 DFPVGKPIWVTGWGALKEGGGAAVILQKAEIRIINQTECNKLLDGQLTP----------RMLCAG 782

  Fly   325 DYILNRDTCQGDSGGPL---QLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDW 385
            ......|.|||||||||   :||       :::  :|.||.|:|..| |.:.|.|||||:...||
 Frog   783 FVSGGIDACQGDSGGPLSSVELN-------NKV--YLAGIVSWGEGCARRNKPGVYTRVAMMRDW 838

  Fly   386 I 386
            |
 Frog   839 I 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 75/261 (29%)
Tryp_SPc 146..386 CDD:214473 73/259 (28%)
st14XP_012821897.2 SEA 76..167 CDD:396113
CUB 216..320 CDD:238001
CUB 328..432 CDD:238001
LDLa 442..474 CDD:238060
LDLa 476..511 CDD:238060
LDLa 513..547 CDD:238060
LDLa 554..587 CDD:197566
Tryp_SPc 604..839 CDD:214473 73/259 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.