DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and prss36

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001005710.1 Gene:prss36 / 448231 XenbaseID:XB-GENE-5892976 Length:719 Species:Xenopus tropicalis


Alignment Length:249 Identity:73/249 - (29%)
Similarity:122/249 - (48%) Gaps:29/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW-VRIGDLDLASEKR 213
            ||.|.:|...::.:   ||  .:.||||:|..:::||||||....::|..: ||:|...||  :.
 Frog    43 AREGAWPWQVSLRY---RG--SHICGGSVIGTQWILTAAHCFGNSQSPSDYEVRLGAYRLA--ET 100

  Fly   214 SVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAM---- 274
            |......:::::..||.|.:..|:.||||::|...::.|.|:.||.|   |....:....|    
 Frog   101 SPNEITAKVDRIIMHPQYDELTYFGDIALIRLTSPIDYTAYILPVCL---PSASNSFTDGMECWV 162

  Fly   275 -GYGATSF--AKPMTNRLTNLNLTVVPNAECNAEL---PPLAETPSGVLESQICAQDYILNRDTC 333
             |:|.|:|  ..|....|..:...::....|:...   .|::.:...:...|||:......:|:|
 Frog   163 TGWGKTAFNVNLPFPGTLQEVMTPLINRTRCDQMYHIDSPVSASSEIIPSDQICSGYSDGGKDSC 227

  Fly   334 QGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRVSSFLDWI 386
            :|||||.|...:      .|:.|. |||.|:|..|. ::.|.|||.|.::..|:
 Frog   228 KGDSGGALVCKI------QRVWYQ-IGIVSWGDGCAIANRPGVYTLVPAYQSWL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 73/249 (29%)
Tryp_SPc 146..386 CDD:214473 72/247 (29%)
prss36NP_001005710.1 Tryp_SPc 37..276 CDD:238113 73/249 (29%)
Tryp_SPc 385..622 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.