DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and ctrl

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:246 Identity:78/246 - (31%)
Similarity:115/246 - (46%) Gaps:36/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAV----GFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKR 213
            |.:|...::    ||        :.||||||::.:|:|||||.  .:|...:|.:|:.|..|...
Zfish    41 GSWPWQVSLQQSNGF--------HFCGGSLINQYWVVTAAHCR--VQAGYHYVILGEHDRGSSAE 95

  Fly   214 SVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWV-FPELPT-TIAFAMGY 276
            ||  |:..|.:...||.|..:.:.:||.||||....:||..:.||.|.. ...:|: |.....|:
Zfish    96 SV--QVKSIAKAITHPYYNSQNFNNDITLLKLSSPAQLTSRISPVCLAASSTSIPSGTRCVTTGW 158

  Fly   277 GAT-SFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGP 340
            |.| |.:.|...:.|.|.|  :..|:|....     ..:.:.::.|||.  .....:||||||||
Zfish   159 GKTGSTSSPRILQQTALPL--LSPAQCKQYW-----GQNRITDAMICAG--ASGVSSCQGDSGGP 214

  Fly   341 LQLNLPGRRRGHRIHYHLIGITSYGVF-CRSSYPSVYTRVSSFLDWIELTV 390
            |.....|.       ::.:||.|:|.. |....|:||.|||....||:..|
Zfish   215 LVCESSGA-------WYQVGIVSWGTSDCNVRTPAVYARVSYLRQWIDQIV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/241 (32%)
Tryp_SPc 146..386 CDD:214473 75/240 (31%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 75/240 (31%)
Tryp_SPc 32..257 CDD:238113 77/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.