DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and zgc:92313

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001002596.1 Gene:zgc:92313 / 436869 ZFINID:ZDB-GENE-040718-339 Length:309 Species:Danio rerio


Alignment Length:274 Identity:71/274 - (25%)
Similarity:107/274 - (39%) Gaps:72/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTS---------IYEAPPK---WVR 202
            |..|.:|....:..|..:    :.|||::|||.:||:||||..         ||....:   |  
Zfish    41 AADGAWPWQVDIQGEKSK----HVCGGTIISENWVLSAAHCFPNPNDISGYLIYAGRQQLNGW-- 99

  Fly   203 IGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELP 267
              :.|..|.         ||.:|.....|.......||||::|......||.::||         
Zfish   100 --NPDETSH---------RISRVVVPLGYTDPQLGQDIALVELATPFVYTERIQPV--------- 144

  Fly   268 TTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILN--- 329
                 .:.|....|...|...:|...  .:........:.||.|....:::||||...::.|   
Zfish   145 -----CLPYANVEFTSDMRCMITGWG--DIREGVALQGVGPLQEVQVPIIDSQICQDMFLTNPTE 202

  Fly   330 -----------------RDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVY 376
                             :|:|||||||||...:..   |..:.   .||.|:|:.| .::.|.||
Zfish   203 NIDIRPDMMCAGFQQGGKDSCQGDSGGPLACQISD---GSWVQ---AGIVSFGLGCAEANRPGVY 261

  Fly   377 TRVSSFLDWIELTV 390
            .:||||.::|:..|
Zfish   262 AKVSSFTNFIQTHV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/269 (26%)
Tryp_SPc 146..386 CDD:214473 69/268 (26%)
zgc:92313NP_001002596.1 Tryp_SPc 34..271 CDD:214473 69/268 (26%)
Tryp_SPc 35..274 CDD:238113 70/271 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.