DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Gm5771

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:273 Identity:83/273 - (30%)
Similarity:130/273 - (47%) Gaps:55/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AVAADANDADFDGRVLARPGEYPHMAAV--GFESDRGQVDYKCGGSLISERFVLTAAHC--TSIY 194
            |||...:|....|....|....|:..::  |:        :.||||||::::|::||||  |.|.
Mouse    13 AVAFPVDDDKIVGGYTCRENSVPYQVSLNSGY--------HFCGGSLINDQWVVSAAHCYKTRIQ 69

  Fly   195 EAPPKWVRIGDLDLASEKRSVEA--QLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRP 257
                  ||:|:.::    :.:|.  |.:...::..|||:.:|...:||.|:||...|.|...|..
Mouse    70 ------VRLGEHNI----KVLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVAT 124

  Fly   258 VRLWVFPELPTTIAFA------MGYGAT-SFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSG 315
            |      .||::.|.|      .|:|.| ||.....:.|..|:..::|.|:|.|..      |..
Mouse   125 V------ALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASY------PGK 177

  Fly   316 VLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRV 379
            :..:.:||......:|:||||||||:..|           ..|.||.|:|..|. :..|.|||:|
Mouse   178 ITGNMVCAGFLEGGKDSCQGDSGGPVVCN-----------GELQGIVSWGYGCALADNPGVYTKV 231

  Fly   380 SSFLDWIELTVWA 392
            .:::|||:.|:.|
Mouse   232 CNYVDWIQDTIAA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/254 (30%)
Tryp_SPc 146..386 CDD:214473 75/253 (30%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 75/256 (29%)
Tryp_SPc 23..241 CDD:238113 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.