DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Try10

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001034085.1 Gene:Try10 / 436522 MGIID:3687012 Length:246 Species:Mus musculus


Alignment Length:278 Identity:83/278 - (29%)
Similarity:135/278 - (48%) Gaps:64/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AVAADANDAD-FDGRVLARPGEYPHMAAV--GFESDRGQVDYKCGGSLISERFVLTAAHCTSIYE 195
            |||...:|.| ..|....|....|:..::  |:        :.||||||::::|::||||   |:
Mouse    13 AVAFPVDDDDKIVGGYTCRENSVPYQVSLNSGY--------HFCGGSLINDQWVVSAAHC---YK 66

  Fly   196 APPKWVRIGDLD---LASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRP 257
            :..: ||:|:.:   |...::.::|     ..:..||.:|||...:||.|:||...|.|...|..
Mouse    67 SRIQ-VRLGEHNINVLEGNEQFIDA-----ANIIKHPKFKKKTLDNDIMLIKLSSPVTLNARVAT 125

  Fly   258 VRLWVFPELPTTIAFA------MGYGATSFAKPMTNRLTN------LNLTVVPNAECNAELPPLA 310
            |      .||::.|.|      .|:|.|     :::.:.|      |:..::|.|:|.|..    
Mouse   126 V------ALPSSCAAAGTQCLISGWGNT-----LSSGVNNPDLLQCLDAPLLPQADCEASY---- 175

  Fly   311 ETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPS 374
              |..:.::.||.......:|:||||||||:..|  |:         |.||.|:|..| :...|.
Mouse   176 --PGKITKNMICVGFLEGGKDSCQGDSGGPVVCN--GQ---------LQGIVSWGYGCAQKDNPG 227

  Fly   375 VYTRVSSFLDWIELTVWA 392
            |||:|.:::|||:.|:.|
Mouse   228 VYTKVCNYVDWIQNTIAA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 75/258 (29%)
Tryp_SPc 146..386 CDD:214473 74/257 (29%)
Try10NP_001034085.1 Tryp_SPc 23..239 CDD:214473 74/260 (28%)
Tryp_SPc 24..242 CDD:238113 76/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.