DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG9733

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:395 Identity:97/395 - (24%)
Similarity:149/395 - (37%) Gaps:114/395 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RDIVFPELDAGPGKPEEKMWFHITDFQFDRVEGPTQPKPKPRQYPPPPMPGQ------------- 97
            :|..||:..|..|..||:   ....|.|.|.|      .:|..:...|...:             
  Fly    90 QDRTFPDYGAFGGDWEEE---RPQSFVFPRQE------RRPWSFGNQPATSRTPFRKSSTSDGSS 145

  Fly    98 --PFPPPPGGFKKKENKQRRLCEQKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAA 160
              |.||..||...:                .||:        |..|.|.:        |:|.|..
  Fly   146 LLPQPPSCGGVGIR----------------NRIY--------DGQDTDVN--------EFPWMVL 178

  Fly   161 VGFESDRGQ-VDYKCGGSLISERFVLTAAHC----------TSIYEAPPKWVRIGDLDLASE--- 211
            :.:....|. :...|.||||:.|:|||||||          |.:.      ||:|:.|..:.   
  Fly   179 LEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVS------VRLGEHDTRTAVDC 237

  Fly   212 -----KRSVEAQLLRIEQVFAHPNYKKKM--YYDDIALLKLEKEVELTEYVRPVRLWVFPELPTT 269
                 ..|.|.|.|..|::..|..|.:|.  ...||.|:::|:.|..::.::|:.      ||::
  Fly   238 PPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPIC------LPSS 296

  Fly   270 IAF----------AMGYGAT-SFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICA 323
            :..          ..|:|.| ..|:....:...:|  .|..|:|...   .::....:..:|:||
  Fly   297 VGLESRQSGQQFTVAGWGRTLKMARSAVKQKVTVN--YVDPAKCRQR---FSQIKVNLEPTQLCA 356

  Fly   324 QDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
            ... ..:|:|.|||||||.       |.....:.|.||.|:|..| ...:|.|||.|:::..||.
  Fly   357 GGQ-FRKDSCDGDSGGPLM-------RFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIR 413

  Fly   388 LTVWA 392
            ..|.|
  Fly   414 QNVRA 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/273 (26%)
Tryp_SPc 146..386 CDD:214473 70/272 (26%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 75/291 (26%)
Tryp_SPc 162..415 CDD:238113 76/293 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.