DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG11841

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:289 Identity:93/289 - (32%)
Similarity:145/289 - (50%) Gaps:34/289 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KYSEYV--ERI----FPNDTAVAADANDADFDGRVL------ARPGEYPHMAAVGFESDRGQVDY 172
            |:.:.|  ||:    |..|..:..:..|:....|.|      |.|.|:|..|.:|......::.:
  Fly    36 KFKQIVFEERVAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKW 100

  Fly   173 KCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYY 237
            .|||:|||.|.|||||||..........||:|:|:..::....|.:...:..:.|||.::....|
  Fly   101 FCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLY 165

  Fly   238 DDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAF-AMGYGATSFAKPMTNRLTNLNL-----TV 296
            :||.:::|::||:...|..|..| .|.:.....:| |:|:|...||:..:.:|..:.|     ..
  Fly   166 NDIGIVQLDREVKFNRYKHPACL-PFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRC 229

  Fly   297 VPNAECNAELPPLAETPSGVLESQIC--AQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLI 359
            |.:.:.|.|||...|.     :||:|  ::|   |:|||.||||||:.    ...:.....||::
  Fly   230 VSSVDANDELPNGYEP-----KSQLCIGSRD---NKDTCNGDSGGPVL----AYHKDLACMYHVM 282

  Fly   360 GITSYGVFCRS-SYPSVYTRVSSFLDWIE 387
            ||||.|:.|.: ..||.||||..||:||:
  Fly   283 GITSAGITCSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 85/255 (33%)
Tryp_SPc 146..386 CDD:214473 84/254 (33%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 83/251 (33%)
Tryp_SPc 72..310 CDD:214473 82/250 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.