DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG4815

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:250 Identity:62/250 - (24%)
Similarity:104/250 - (41%) Gaps:52/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 MAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVE------ 216
            :..||.:...|: ...|..:|::.|.:||||||...... .|:..||.       :|.|      
  Fly    46 LGGVGIQLFNGR-KLVCSATLLTPRHILTAAHCFENLNR-SKFHVIGG-------KSAEFTWHGN 101

  Fly   217 ----AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLW--VFPELPTTIAFAMG 275
                .:|:|::   .||.|.|..:..|:|:.|.:..:. ::|:...:|.  |.......||...|
  Fly   102 NFNKNKLIRVQ---IHPKYAKMKFIADVAVAKTKYPLR-SKYIGYAQLCRSVLHPRDKLIAAGWG 162

  Fly   276 YGATSFAKPMTNRLTNLNLTVVPNAECNAEL----PPLAETPSGVLESQICAQDYILNRDTCQGD 336
            :....:.:.......::.:.:|...:|..:|    ||          :.|||..| .|:..|.||
  Fly   163 FEGGVWDESRKKTFRSMKVGIVSKRDCEKQLDRKMPP----------NIICAGAY-NNKTLCFGD 216

  Fly   337 SGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIELTV 390
            |||||.|   ||:        :.||.::...| .:..|.||..|..:..:|:.|:
  Fly   217 SGGPLLL---GRQ--------VCGINTWTFKCGNNEKPDVYMGVRYYAKFIKRTI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 60/245 (24%)
Tryp_SPc 146..386 CDD:214473 60/244 (25%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 61/244 (25%)
Trypsin 49..256 CDD:278516 60/241 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.