DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and grass

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:360 Identity:96/360 - (26%)
Similarity:156/360 - (43%) Gaps:92/360 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GQPFPPPPGGFKKKENKQRRLCE-----QK----YSEYVERI-----------------FPNDTA 134
            ||..|     |......:.||.|     ||    |:.|:::.                 ..:::.
  Fly    40 GQCMP-----FSSCRTIEERLTEAQKAGQKVPADYASYLQKALCGEFNGVRHFCCPSANIQHNSK 99

  Fly   135 VAADANDADFD-GRVLA---------RPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAH 189
            |.:...|.:|| |..|:         :....|.||.:.:: ..|:..:.|||::||||::|||||
  Fly   100 VMSLFKDENFDCGNFLSQRVSNGYEVKLSSRPWMALLRYQ-QFGESRFLCGGAMISERYILTAAH 163

  Fly   190 C-----TSIYEAPPKWVRIGDLDLASE--------KRSVEAQLLR--IEQVFAHPNYKKKMYYDD 239
            |     ..:||     :|:|:..:::|        |:.....::.  ||:...|..|..:....|
  Fly   164 CVHGLQNDLYE-----IRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHD 223

  Fly   240 IALLKLEKEVELTEYVRPVRLWVFPEL-----PTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPN 299
            ||||||.:.|...::::|:.|.:..||     ..:..|..|:|.|.... .::.|...|:.:.|.
  Fly   224 IALLKLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGS-SSDVLLQANVPLQPR 287

  Fly   300 AECN---AELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGH----RIHYH 357
            :.|:   ....||         ||:|.....| :|:|:||||||||  .|.:..|.    .:.: 
  Fly   288 SACSQAYRRAVPL---------SQLCVGGGDL-QDSCKGDSGGPLQ--APAQYLGEYAPKMVEF- 339

  Fly   358 LIGITSYGVF-C-RSSYPSVYTRVSSFLDWIELTV 390
              ||.|.||. | :.|.|.:||.|..::.||..|:
  Fly   340 --GIVSQGVVTCGQISLPGLYTNVGEYVQWITDTM 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 79/278 (28%)
Tryp_SPc 146..386 CDD:214473 78/277 (28%)
grassNP_651543.1 CLIP 32..90 CDD:197829 11/54 (20%)
Tryp_SPc 121..371 CDD:238113 78/271 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.