DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Tmprss9

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:339 Identity:96/339 - (28%)
Similarity:154/339 - (45%) Gaps:66/339 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RVEGPTQPKPKPRQYPPPPMPGQPFPPPPGGFKKKENKQRRLCEQKYSEYVERIFPNDTAVAADA 139
            |.|||.    ..|.......||..|....|....|||.:   |:       :|:..:|     ::
Mouse   392 RCEGPV----TERDLKSGHCPGNVFSCQNGQCVSKENPE---CD-------DRVDCSD-----ES 437

  Fly   140 NDADFD----------GRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC 190
            ::|..|          ||::    |.|||:|...::     |...::.||.::|..|::::||||
Mouse   438 DEAQCDCGWQPAWRSAGRIVGGVEAAPGEFPWQVSL-----RENHEHFCGATIIGARWLVSAAHC 497

  Fly   191 TSIYEAPPKW-VRIGDLDLA-SEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTE 253
            .:.::.|.:| .:.|.:.|: ||..:|..::|||.:   ||.|.......|:|:|:|.:.:....
Mouse   498 FNEFQDPAQWAAQAGSVHLSGSEASAVRTRVLRIAK---HPAYDADTADFDVAVLELARPLPFGR 559

  Fly   254 YVRPVRL----WVFPELPTTIAFAMGYGATSF-AKPMTNRLTNLNLTVVPNAECNAELPPLAETP 313
            ||:|..|    .|||.....:....||....| .||..  |....:.::..:.|::..      .
Mouse   560 YVQPACLPAATHVFPPGKKCLISGWGYLKEDFLVKPEV--LQKATVELLDQSLCSSLY------G 616

  Fly   314 SGVLESQICAQDYILNR-DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVY 376
            ..:.:..:|| .|:..: |:|||||||||....|..|      :.|.||.|:|:.| .:..|.||
Mouse   617 HSLTDRMVCA-GYLDGKVDSCQGDSGGPLVCEEPSGR------FFLAGIVSWGIGCAEARRPGVY 674

  Fly   377 TRVSSFLDWI-ELT 389
            |||:...||| |:|
Mouse   675 TRVTRLRDWILEVT 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/254 (30%)
Tryp_SPc 146..386 CDD:214473 75/252 (30%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060 11/49 (22%)
Tryp_SPc 455..684 CDD:214473 74/251 (29%)
Tryp_SPc 756..984 CDD:214473
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.