DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG10232

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:355 Identity:106/355 - (29%)
Similarity:146/355 - (41%) Gaps:93/355 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PGQPFPPPPGGFKKKENKQRRL--CEQKYSEYVE---RIFPNDTAVAADANDADFD--------- 145
            |.|.||..|.     :.|..||  |.:.::..:|   .:..| ...|.|....|.|         
  Fly   181 PKQEFPDCPA-----DEKCIRLDKCLRIHNTTMEDGANLMDN-RQCAIDTRRIDSDKRHYICCPE 239

  Fly   146 -GRVL------------------ARPGEYPHMAAVGFESDR-GQVDYKCGGSLISERFVLTAAHC 190
             |.||                  |||.|||.||.:.:|:.| ..:...|.||||::|:|||||||
  Fly   240 PGNVLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHC 304

  Fly   191 --------TSIYEAPPKWVRIGDLDLASEKRS----------VEAQLLRIEQVFAHPNY-KKKMY 236
                    |.:.   .:.||:|:.|:.:....          ||   :.||....|..| ....:
  Fly   305 VVKDKMVNTDLV---LRRVRLGEHDITTNPDCDFTGNCAAPFVE---IGIEYFNVHEQYFNTSRF 363

  Fly   237 YDDIALLKLEKEVELTEYVRPVRLWVFP----ELPTTIAFAMGYGATSFAKPMTNRLTN---LNL 294
            ..||||::|:..|..|..:.|:.:...|    ..|..||   |:|.|.      ||..:   |:.
  Fly   364 ESDIALVRLQTPVRYTHEILPICVPKDPIPLHNHPLQIA---GWGYTK------NREYSQVLLHN 419

  Fly   295 TVVPNA-ECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHL 358
            ||..|. .|..::.....      ||||||.. |...|:|:|||||||.|.|   ...::...:|
  Fly   420 TVYENRYYCQDKISFFRN------ESQICASG-IRGEDSCEGDSGGPLMLTL---NNDYQDIVYL 474

  Fly   359 IGITSYG-VFCRSSYPSVYTRVSSFLDWIE 387
            .||.||| ..|....|.|||:..:|..||:
  Fly   475 AGIVSYGSENCGDRKPGVYTKTGAFFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 90/287 (31%)
Tryp_SPc 146..386 CDD:214473 89/286 (31%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 88/270 (33%)
Tryp_SPc 260..503 CDD:214473 86/267 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.