DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG16710

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:333 Identity:95/333 - (28%)
Similarity:154/333 - (46%) Gaps:63/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 FKKKEN---KQRRLCEQKY-------SEYVERIF---PN------DTAVAADANDA--DFDGRVL 149
            |.|..|   .::.:.|.:|       .|.::|:.   ||      :|.:......|  .|.|.. 
  Fly    48 FLKPHNMTPAEKAVFEDRYCGYGPKGQELLDRVLICCPNMGHILPNTQICGPIMPAYRIFGGEE- 111

  Fly   150 ARPGEYPHMAAVGFESDRGQVDY------KCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDL 208
            .:|.|.|.||.:.: :.|.:..:      :|.||||:.|:|||||||..|.....:.||:|:.::
  Fly   112 TQPNELPWMALILY-AHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRVRLGEHNI 175

  Fly   209 AS-----------EKRSVEAQLLRIEQVFAHPNYK--KKMYYDDIALLKLEKEVELTEYVRPVRL 260
            .|           |..:.|...:.::....|.:|.  ::..|:|||||:|:..|..|..::|:.:
  Fly   176 LSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQIKPICV 240

  Fly   261 ---WVF--PELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGV-LES 319
               ::|  |..........|:|.:.     ....:|:.|....|.. ||:...|:|...|: .|:
  Fly   241 QLDYIFSNPSFSNHKLQIAGWGLSH-----KQGYSNVLLQAYVNGR-NADECSLSEPSLGLDKET 299

  Fly   320 QICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSY-PSVYTRVSSFL 383
            .|||.: :...|||:|||||||...:   .||.....:|.|||||| :.:..| |:.||:.|.|:
  Fly   300 HICAGN-LGGNDTCKGDSGGPLMAIM---ERGDEEFVYLAGITSYG-YSQCGYGPAAYTKTSKFV 359

  Fly   384 DWIELTVW 391
            :||   :|
  Fly   360 EWI---LW 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 81/266 (30%)
Tryp_SPc 146..386 CDD:214473 80/265 (30%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 7/35 (20%)
Tryp_SPc 105..362 CDD:214473 81/269 (30%)
Tryp_SPc 106..362 CDD:238113 81/268 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.