DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG31199

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:272 Identity:62/272 - (22%)
Similarity:109/272 - (40%) Gaps:69/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAV----GFESDRGQV-DYKCGGSLISERFVLTAAHCTSIY--------------- 194
            |.|.|:..:|.:    |||   |:: |..|.|.|:|:|.||..|||...|               
  Fly    45 AIPTEHQWVARIVYGKGFE---GKIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHN 106

  Fly   195 EAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVR 259
            ::.|..||:.:.|....:.|.|   :::.::..||:|..:...:.:|:|.|:::.::...|.|:.
  Fly   107 KSAPVGVRVCETDGYCVRPSQE---IKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPIC 168

  Fly   260 LWVFPELPTTIAFAMGY---GATSF----AKPMTNRLTN-------LNLTVVPNAECNAELPPLA 310
            : ..|.|......|..:   |...|    .|...|.|:.       ..|....|..|.....|:|
  Fly   169 M-PPPSLLNETLVAQTFVVAGLRVFEDFRLKTWVNTLSRGFCQSKVKTLVTSSNTVCGYHKQPVA 232

  Fly   311 ETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGH-RIHYHLIGITSYGVFCRSSYPS 374
                           |.|         |.|| :.|  :::|| ..:|:|:||.....:..:...|
  Fly   233 ---------------YYL---------GAPL-VGL--QKKGHVTQNYYLVGIMIDWRWENNRIMS 270

  Fly   375 VYTRVSSFLDWI 386
            .:..:.:::|:|
  Fly   271 SFLAIRNYMDFI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 62/272 (23%)
Tryp_SPc 146..386 CDD:214473 61/270 (23%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 57/245 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.