DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG7432

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:254 Identity:83/254 - (32%)
Similarity:130/254 - (51%) Gaps:28/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCT-----SIYEAPPKWVRIGD 205
            |.|.|..|::|.|||:.....: :.::.||||||..:::|||||||     ..:.|....||:||
  Fly   477 GGVEAPNGQWPWMAAIFLHGPK-RTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVRLGD 540

  Fly   206 LDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPV------RLWVFP 264
            :||:::....:.....:::|..|..:.:..:|:|||:|.|:|.|..::||.||      |:....
  Fly   541 IDLSTDAEPSDPVTFAVKEVRTHERFSRIGFYNDIAILVLDKPVRKSKYVIPVCLPKGIRMPPKE 605

  Fly   265 ELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECN-AELPPLAETPSGVLESQICAQDYIL 328
            .||...|..:|:|.|.:....:.......|.:..|.:|: :...|       :.|:.|||.....
  Fly   606 RLPGRRATVVGWGTTYYGGKESTSQRQAELPIWRNEDCDRSYFQP-------INENFICAGYSDG 663

  Fly   329 NRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            ..|.|||||||||.:.       :..|:..:|:.|:|..| ...||.|||||:.:||||
  Fly   664 GVDACQGDSGGPLMMR-------YDSHWVQLGVVSFGNKCGEPGYPGVYTRVTEYLDWI 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 83/254 (33%)
Tryp_SPc 146..386 CDD:214473 81/252 (32%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 81/252 (32%)
Tryp_SPc 475..718 CDD:238113 83/254 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.