DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG7142

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:275 Identity:78/275 - (28%)
Similarity:119/275 - (43%) Gaps:67/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFES-DRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRI-GDLDLASEK 212
            |.|...|::.::...: |:|.|.| |.|::|:|.::||||||.|..:|....|.: |..|:..:|
  Fly    86 ATPHSAPYVVSIQMMTPDQGLVHY-CAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQK 149

  Fly   213 -RSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGY 276
             .:...|:..|:....|..|...:...||||:..::.:....||:|.      .||...|...||
  Fly   150 GEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPA------TLPEQDAQPEGY 208

  Fly   277 GATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNR----------- 330
            | |.:.      ..|:::|.|||....     |.|....:|:.::|.|  ||.|           
  Fly   209 G-TLYG------WGNVSMTAVPNYPHR-----LQEANMPILDMELCEQ--ILARSGLPLHETNLC 259

  Fly   331 --------DTCQGDSGGPL----------QLNLPGRRRGHRIHYHLIGITSYGVF-C-RSSYPSV 375
                    ..|..||||||          |.|:            :|||.|:|.. | :.:.|||
  Fly   260 TGPLTGGVSICTADSGGPLIQQCCEEHFEQANI------------VIGIVSWGKMPCGQKNAPSV 312

  Fly   376 YTRVSSFLDWIELTV 390
            :.|||:|.:||...:
  Fly   313 FVRVSAFTEWINQVI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/270 (29%)
Tryp_SPc 146..386 CDD:214473 76/269 (28%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 78/272 (29%)
Tryp_SPc 84..323 CDD:214473 76/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.