DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG31266

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:322 Identity:81/322 - (25%)
Similarity:132/322 - (40%) Gaps:70/322 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VEGPTQPKPKPRQYPPPPMPGQPFPPPPGGFKKKENKQRRLCEQKYSEYVERIFPNDTAVAADAN 140
            ::|||:..         .|.|:|.|    |....|..:                         :.
  Fly    18 LQGPTEAM---------RMRGEPLP----GLANIERHR-------------------------ST 44

  Fly   141 DADFDGRVL----ARPGEYPHMAAVGFESDRGQVDYK-CGGSLISERFVLTAAHCTSIYEAPPKW 200
            :|...|||:    |..|.:|.:|::     :....|. ||..::.|.:|||||.|.:........
  Fly    45 EAVPQGRVIGGTTAAEGNWPWIASI-----QNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLL 104

  Fly   201 VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE 265
            |..|.:|.    ..:.|....:.|:..|.|:.|.:|::|||||:|..::|..:..:.:.|....|
  Fly   105 VVTGTVDW----WDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDE 165

  Fly   266 LP--TTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYIL 328
            |.  ..:.|| |:|::.........|...:.|.:|...|..:|....:...|    .:|.| ...
  Fly   166 LEEGDKLTFA-GWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLG----HVCVQ-MDA 224

  Fly   329 NRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWIELTV 390
            .:..|.||:||||   :..::|       |:||.::||.|...||.||.|.:.:.|||..|:
  Fly   225 GQGACHGDTGGPL---IDEQQR-------LVGIGNWGVPCGRGYPDVYARTAFYHDWIRTTM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/247 (28%)
Tryp_SPc 146..386 CDD:214473 68/246 (28%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 67/245 (27%)
Tryp_SPc 52..275 CDD:238113 68/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.