DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG17475

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:276 Identity:70/276 - (25%)
Similarity:103/276 - (37%) Gaps:77/276 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 ANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYK-----------CGGSLISERFVLTAAHCTS 192
            |...:|..||:.           |.:...|:..|:           |||.:|.||.|||||||  
  Fly    41 AEGVNFQNRVIN-----------GEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHC-- 92

  Fly   193 IYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRP 257
            :|...|.::|:....:..||...   :..:|:.:.|.||....|::||||::|...::..||.:|
  Fly    93 VYGYNPTYLRVITGTVEYEKPDA---VYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQP 154

  Fly   258 VRLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQIC 322
            ..|...|....|.....|:|:|.......:.|....||.|..:.|..                  
  Fly   155 AELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQE------------------ 201

  Fly   323 AQDYILNRD-----------------TCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRS 370
                |:|.|                 .|.|||||||..|           ..|.|:.::|..|..
  Fly   202 ----IMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHN-----------GVLYGLVNWGYPCAL 251

  Fly   371 SYPSVYTRVSSFLDWI 386
            ..|..:..|..:|:||
  Fly   252 GVPDSHANVYYYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 68/269 (25%)
Tryp_SPc 146..386 CDD:214473 66/267 (25%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 66/266 (25%)
Tryp_SPc 50..269 CDD:238113 67/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.