DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Sb

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:273 Identity:83/273 - (30%)
Similarity:123/273 - (45%) Gaps:62/273 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 LARP------------GEYPHMAAV------GFESDRGQVDYKCGGSLISERFVLTAAHCTSIYE 195
            ||||            |.:|...:|      ||.|     .::|||:||:|.::.||.||.....
  Fly   537 LARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSS-----THRCGGALINENWIATAGHCVDDLL 596

  Fly   196 APPKWVRIGDLDLASEKRSVEAQLLRIEQVFA----HPNYKKKMYYDDIALLKLEKEVELTEYVR 256
            .....:|:|:.|.:    .|:.||..||:..|    ||.|....|..|:||:|||:.:|...:|.
  Fly   597 ISQIRIRVGEYDFS----HVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPHVS 657

  Fly   257 PVRLWVFPELPTTI----AFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNA--------ELPPL 309
            |:.|   ||..:.:    |...|:|..|....:.:.|..:::.:|.|..|.:        |..| 
  Fly   658 PICL---PETDSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFIP- 718

  Fly   310 AETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYP 373
                    :..:||......:|:||||||||||......|      :.|.||.|:|:.| .::.|
  Fly   719 --------DIFLCAGYETGGQDSCQGDSGGPLQAKSQDGR------FFLAGIISWGIGCAEANLP 769

  Fly   374 SVYTRVSSFLDWI 386
            .|.||:|.|..||
  Fly   770 GVCTRISKFTPWI 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 83/273 (30%)
Tryp_SPc 146..386 CDD:214473 81/271 (30%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 77/265 (29%)
Tryp_SPc 544..785 CDD:238113 79/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.