DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG9631

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:354 Identity:95/354 - (26%)
Similarity:135/354 - (38%) Gaps:111/354 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PTQPKPKPRQY-----PPPPMPG---QPFPPPPGGFKKKENKQRRLCEQKYSEYVERIFPNDTAV 135
            |...|..||:.     |||..|.   .||.|                     ..:.||       
  Fly   145 PISQKSAPREIVRQRRPPPSTPSNDPNPFLP---------------------SIMPRI------- 181

  Fly   136 AADANDADFD------------GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAA 188
                 |:||:            |..|...|:||.:||: :|. .|...|||..|:||:|.|:|||
  Fly   182 -----DSDFEECGVEGFSPLQIGGDLVTRGQYPWLAAL-YEG-VGTATYKCVVSVISKRTVITAA 239

  Fly   189 HCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYD-DIALLKLEKEVELT 252
            ||.....|...||.:|..| .:|.....|.|:.:..|.....|:.....| |:.||.|...:..|
  Fly   240 HCIYGKSASQLWVYLGRHD-RNENPENGASLVSVTSVLTPSAYEGNPVPDADVGLLVLTSPMVYT 303

  Fly   253 EYVRPVRLW-----VFPELPTTIAFAMGYG------ATSFAKPMTNRLTNLNLTVVPNAECNAEL 306
            :|:||:.||     :.|....|.|.| |:|      .|.|.|.::.||       ||..:|..|:
  Fly   304 KYIRPLCLWGSNMGLPPNEGDTGAVA-GWGYDRSAQKTRFPKTVSVRL-------VPRDQCLKEM 360

  Fly   307 PPLAETPSGVLESQICAQDYILNRDTCQ----------GDSGGPLQLNLPGRRRGHRIHYHLIGI 361
            ..              |:|:|..|..|.          ||||..|.:     .|.:|  :::.|:
  Fly   361 KR--------------AEDFITRRTVCAGNSESHGPCFGDSGSALIV-----LRNNR--WYVRGV 404

  Fly   362 TS----YGVFCRSSYPSVYTRVSSFLDWI 386
            .|    :|..|..|...:|..|:..:||:
  Fly   405 VSLSPRHGEICDLSKYVIYCDVARHIDWV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 79/267 (30%)
Tryp_SPc 146..386 CDD:214473 78/265 (29%)
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 79/268 (29%)
Tryp_SPc 198..433 CDD:214473 78/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.