DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG11670

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:345 Identity:166/345 - (48%)
Similarity:210/345 - (60%) Gaps:33/345 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PTQPKPKP---RQYP--PPPMPGQPFPPP-----PGG---FKKKENKQRRLCEQKYSEYVERIFP 130
            |..|.|.|   |..|  |||.|..|.|||     |||   .::.:|..|:...::......|.|.
  Fly    78 PPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGPGGPLQHRQWDNGPRQWQPRRPPPNHHRNFH 142

  Fly   131 ---------------NDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLIS 180
                           |.||...|.:| ||:||.:..||:||||||:||.::..::||||||||||
  Fly   143 NIFLNTESKVDGENYNKTAETEDLHD-DFNGRSIVAPGQYPHMAALGFRNENHEIDYKCGGSLIS 206

  Fly   181 ERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKL 245
            |.||||||||.:.:...|..|:|||:.|...:.:|..|..|:.|::.||.|...:.|.||.|::|
  Fly   207 EEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELNVAPQRRRVAQIYLHPLYNASLNYHDIGLIQL 271

  Fly   246 EKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLA 310
            .:.||.|.:|||||||...::|......||||:|.||:|.||.||.|:|:|||..:||:.||...
  Fly   272 NRPVEYTWFVRPVRLWPMNDIPYGKLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADE 336

  Fly   311 ETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGH--RIH--YHLIGITSYGVFCRSS 371
            .:|.|:|.|||||.||..|||||||||||||||||..|||.|  |.|  |:|:||||||.:|||.
  Fly   337 GSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAYCRSE 401

  Fly   372 YPSVYTRVSSFLDWIELTVW 391
            .|.|||||||::|||...||
  Fly   402 LPGVYTRVSSYIDWIASIVW 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 135/244 (55%)
Tryp_SPc 146..386 CDD:214473 134/243 (55%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 136/246 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012732
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.